SCOPe 2.05: Domain d4zdqc_: 4zdq C:

Lineage for d4zdqc_ (4zdq C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (23 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [271140] (2 PDB entries)

8. Domain d4zdqc_: 4zdq C: [272113]
   automated match to d2xwna_
   complexed with act, cad, ctp, gol, mg

Details for d4zdqc_

PDB Entry: 4zdq, 2.3 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis complexed with ctp

PDB Compounds: (C:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4zdqc_:

Sequence, based on SEQRES records:

>d4zdqc_ c.68.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mvtsrlfalipcagtgsrsgsalpkqyrtlagrallhytlaafdacsefaqtlvvispdd
ahfdarrfaglrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpali
rtligalkddpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrda
iqraqlegrdltdeasaiewaghtprvvqgslrnfkvtypedfdlaeailahp

Sequence, based on observed residues (ATOM records):

>d4zdqc_ c.68.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mvtsrlfalipcalpkqyrtlagrallhytlaafdacsefaqtlvvispddahfdarrfa
glrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirtligalkd
dpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiqraqlegr
dltdeasaiewaghtprvvqgslrnfkvtypedfdlaeailahp

Timeline for d4zdqc_:

• d4zdqc_ is new in SCOPe 2.05-stable
  
• d4zdqc_ is called d4zdqc1 in SCOPe 2.06
  
• d4zdqc_ appears in the current release, SCOPe 2.08, called d4zdqc1