Lineage for d4zdqc1 (4zdq C:2-232)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2474233Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2474234Protein automated matches [190951] (26 species)
    not a true protein
  7. 2474263Species Burkholderia thailandensis [TaxId:271848] [271140] (2 PDB entries)
  8. 2474266Domain d4zdqc1: 4zdq C:2-232 [272113]
    Other proteins in same PDB: d4zdqb2, d4zdqc2
    automated match to d2xwna_
    complexed with act, cad, ctp, gol, mg

Details for d4zdqc1

PDB Entry: 4zdq (more details), 2.3 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis complexed with ctp
PDB Compounds: (C:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4zdqc1:

Sequence, based on SEQRES records: (download)

>d4zdqc1 c.68.1.0 (C:2-232) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcagtgsrsgsalpkqyrtlagrallhytlaafdacsefaqtlvvispddah
fdarrfaglrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirt
ligalkddpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiq
raqlegrdltdeasaiewaghtprvvqgslrnfkvtypedfdlaeailahp

Sequence, based on observed residues (ATOM records): (download)

>d4zdqc1 c.68.1.0 (C:2-232) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcalpkqyrtlagrallhytlaafdacsefaqtlvvispddahfdarrfagl
rfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirtligalkddp
vggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiqraqlegrdl
tdeasaiewaghtprvvqgslrnfkvtypedfdlaeailahp

SCOPe Domain Coordinates for d4zdqc1:

Click to download the PDB-style file with coordinates for d4zdqc1.
(The format of our PDB-style files is described here.)

Timeline for d4zdqc1: