SCOPe 2.08: Domain d4zdqc1: 4zdq C:2-232

Lineage for d4zdqc1 (4zdq C:2-232)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (34 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [271140] (2 PDB entries)

8. Domain d4zdqc1: 4zdq C:2-232 [272113]
   Other proteins in same PDB: d4zdqb2, d4zdqc2
   automated match to d2xwna_
   complexed with act, cad, ctp, gol, mg

Details for d4zdqc1

PDB Entry: 4zdq, 2.3 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis complexed with ctp

PDB Compounds: (C:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4zdqc1:

Sequence, based on SEQRES records:

>d4zdqc1 c.68.1.0 (C:2-232) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcagtgsrsgsalpkqyrtlagrallhytlaafdacsefaqtlvvispddah
fdarrfaglrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirt
ligalkddpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiq
raqlegrdltdeasaiewaghtprvvqgslrnfkvtypedfdlaeailahp

Sequence, based on observed residues (ATOM records):

>d4zdqc1 c.68.1.0 (C:2-232) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcalpkqyrtlagrallhytlaafdacsefaqtlvvispddahfdarrfagl
rfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirtligalkddp
vggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiqraqlegrdl
tdeasaiewaghtprvvqgslrnfkvtypedfdlaeailahp

Timeline for d4zdqc1:

• d4zdqc1 first appeared in SCOPe 2.05, called d4zdqc_
  
• d4zdqc1 appears in SCOPe 2.07