SCOPe 2.06: Domain d4yt7l_: 4yt7 L:

Lineage for d4yt7l_ (4yt7 L:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4yt7l_: 4yt7 L: [272058]
   Other proteins in same PDB: d4yt7h_
   automated match to d1klil_
   complexed with 4k1, ca, gol, so4

Details for d4yt7l_

PDB Entry: 4yt7, 2.3 Å

PDB Description: factor viia in complex with the inhibitor 2-(2-{(r)-[(4- carbamimidoylphenyl)amino][5-ethoxy-2-fluoro-3-(propan-2-yloxy) phenyl]methyl}-1h-imidazol-4-yl)benzamide

PDB Compounds: (L:) Coagulation factor VII (light chain)

SCOPe Domain Sequences for d4yt7l_:

Sequence; same for both SEQRES and ATOM records:

>d4yt7l_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4yt7l_:

• d4yt7l_ first appeared in SCOPe 2.05
  
• d4yt7l_ appears in SCOPe 2.07
  
• d4yt7l_ appears in the current release, SCOPe 2.08