SCOPe 2.07: Domain d4xwia_: 4xwi A:

Lineage for d4xwia_ (4xwi A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (33 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272021] (1 PDB entry)

8. Domain d4xwia_: 4xwi A: [272022]
   automated match to d3duva_
   complexed with na, so4

Details for d4xwia_

PDB Entry: 4xwi, 1.92 Å

PDB Description: x-ray crystal structure of cmp-kdo synthase from pseudomonas aeruginosa

PDB Compounds: (A:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d4xwia_:

Sequence; same for both SEQRES and ATOM records:

>d4xwia_ c.68.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
qaftvviparyastrlpgkplqdiagqpmiqrvwnqarksaasrvvvatdderilaacqg
fgaealltraehnsgtdrleevasrlglasdaivvnvqgdeplippalidqvaanlaahp
eaaiatlaepihevsalfnpnvvkvatdidglaltfsraplpwardafardrdslpegvp
yrrhigiyayrvgfladfvawgpcwlenaesleqlralwhgvrihvadarenmlpgvdtp
edlervrrvlgg

Timeline for d4xwia_:

• d4xwia_ first appeared in SCOPe 2.05
  
• d4xwia_ appears in SCOPe 2.06
  
• d4xwia_ appears in the current release, SCOPe 2.08