Lineage for d3cbsa_ (3cbs A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673924Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 673954Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 673961Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (10 PDB entries)
  8. 673968Domain d3cbsa_: 3cbs A: [27202]

Details for d3cbsa_

PDB Entry: 3cbs (more details), 2 Å

PDB Description: cellular retinoic acid binding protein ii in complex with a synthetic retinoic acid (ro-12 7310)
PDB Compounds: (A:) protein (crabp-II)

SCOP Domain Sequences for d3cbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbsa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

SCOP Domain Coordinates for d3cbsa_:

Click to download the PDB-style file with coordinates for d3cbsa_.
(The format of our PDB-style files is described here.)

Timeline for d3cbsa_: