Class b: All beta proteins [48724] (177 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
Protein automated matches [190587] (7 species) not a true protein |
Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [271894] (2 PDB entries) |
Domain d4pdta_: 4pdt A: [271895] automated match to d4oitb_ complexed with so4 |
PDB Entry: 4pdt (more details), 1.4 Å
SCOPe Domain Sequences for d4pdta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pdta_ b.78.1.0 (A:) automated matches {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} syvhpygstlpengvigrgyalisdsgrvefrvtdegniqlflddsrklwsvdgknasfv kmqtdgncvgydpngtavwhtatngddhpynlvcqndgnlvvyakggkavwhtntavvh
Timeline for d4pdta_: