Lineage for d4pdta_ (4pdt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079278Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2079279Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2079331Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 2079332Protein automated matches [190587] (7 species)
    not a true protein
  7. 2079384Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [271894] (2 PDB entries)
  8. 2079386Domain d4pdta_: 4pdt A: [271895]
    automated match to d4oitb_
    complexed with so4

Details for d4pdta_

PDB Entry: 4pdt (more details), 1.4 Å

PDB Description: japanese marasmius oreades lectin
PDB Compounds: (A:) Mannose recognizing lectin

SCOPe Domain Sequences for d4pdta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pdta_ b.78.1.0 (A:) automated matches {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
syvhpygstlpengvigrgyalisdsgrvefrvtdegniqlflddsrklwsvdgknasfv
kmqtdgncvgydpngtavwhtatngddhpynlvcqndgnlvvyakggkavwhtntavvh

SCOPe Domain Coordinates for d4pdta_:

Click to download the PDB-style file with coordinates for d4pdta_.
(The format of our PDB-style files is described here.)

Timeline for d4pdta_: