SCOPe 2.07: Domain d4y30a_: 4y30 A:

Lineage for d4y30a_ (4y30 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)

8. Domain d4y30a_: 4y30 A: [271816]
   automated match to d4c03a_
   complexed with 49l, gol, mg, sah

Details for d4y30a_

PDB Entry: 4y30, 2.1 Å

PDB Description: crystal structure of human protein arginine methyltransferase prmt6 bound to sah and epz020411

PDB Compounds: (A:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d4y30a_:

Sequence; same for both SEQRES and ATOM records:

>d4y30a_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkrerdqlyyecysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsi
fcaqagarrvyaveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmg
ygllhesmlssvlhartkwlkegglllpasaelfiapisdqmlewrlgfwsqvkqhygvd
msclegfatrclmghseivvqglsgedvlarpqrfaqlelsragleqelqagvggrfrcs
cygsapmhgfaiwfqvtfpggesekplvlstspfhpathwkqallylnepvqveqdtdvs
geitllpsrdnprrlrvllrykvgdqeektkdfamed

Timeline for d4y30a_:

• d4y30a_ first appeared in SCOPe 2.05
  
• d4y30a_ appears in SCOPe 2.06
  
• d4y30a_ appears in the current release, SCOPe 2.08