Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Jc polyomavirus [TaxId:10632] [270722] (7 PDB entries) |
Domain d4x15d_: 4x15 D: [271773] automated match to d4mbzj_ complexed with bgc, edo, gal, gol, k, nga, sia |
PDB Entry: 4x15 (more details), 2.11 Å
SCOPe Domain Sequences for d4x15d_:
Sequence, based on SEQRES records: (download)
>d4x15d_ b.121.6.1 (D:) automated matches {Jc polyomavirus [TaxId: 10632]} evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysvar iplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhff svggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdp trnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftn rsgsqqwrglsryfkvqlrkrrvk
>d4x15d_ b.121.6.1 (D:) automated matches {Jc polyomavirus [TaxId: 10632]} evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysvar iplpnlilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggeale lqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentry fgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqwr glsryfkvqlrkrrvk
Timeline for d4x15d_:
View in 3D Domains from other chains: (mouse over for more information) d4x15a_, d4x15b_, d4x15c_, d4x15e_ |