Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d4ozga1: 4ozg A:1-81 [271648] Other proteins in same PDB: d4ozga2, d4ozgb2, d4ozgc2, d4ozgd2, d4ozge1, d4ozge2, d4ozgf1, d4ozgf2, d4ozgg1, d4ozgg2, d4ozgh1, d4ozgh2 automated match to d4ozfa1 complexed with ca, nag |
PDB Entry: 4ozg (more details), 3 Å
SCOPe Domain Sequences for d4ozga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozga1 d.19.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal tniavlkhnlnslikrsnsta
Timeline for d4ozga1: