SCOPe 2.08: Domain d2n0ya_: 2n0y A:

Lineage for d2n0ya_ (2n0y A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.9: TFIIH domain [110272] (3 proteins)

6. Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (9 PDB entries)
   Uniprot P32776 2-115

8. Domain d2n0ya_: 2n0y A: [271643]
   automated match to d2gs0a_

Details for d2n0ya_

PDB Entry: 2n0y

PDB Description: nmr structure of the complex between the c-terminal domain of the rift valley fever virus protein nss and the ph domain of the tfb1 subunit of tfiih

PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d2n0ya_:

Sequence; same for both SEQRES and ATOM records:

>d2n0ya_ b.55.1.9 (A:) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

Timeline for d2n0ya_:

• d2n0ya_ first appeared in SCOPe 2.05
  
• d2n0ya_ appears in SCOPe 2.07