PDB entry 2n0y

View 2n0y on RCSB PDB site
Description: NMR structure of the complex between the C-terminal domain of the Rift Valley fever virus protein NSs and the PH domain of the Tfb1 subunit of TFIIH
Class: transcription/viral protein
Keywords: transcription, virulence, viral protein-transcription complex, drug target, virus-host interface, TRANSCRIPTION-VIRAL PROTEIN complex
Deposited on 2015-03-18, released 2015-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: D9740.3, TFB1, YDR311W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (0-114)
      • engineered mutation (0)
    Domains in SCOPe 2.08: d2n0ya_
  • Chain 'B':
    Compound: Non-structural protein NS-S
    Species: Rift valley fever virus [TaxId:11589]
    Gene: nss
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21698 (5-23)
      • expression tag (0-4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n0yA (A:)
    pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
    rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad
    

  • Chain 'B':
    No sequence available.