Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.310: VC0467-like [143455] (1 superfamily) complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel |
Superfamily d.310.1: VC0467-like [143456] (2 families) automatically mapped to Pfam PF02622 |
Family d.310.1.0: automated matches [271638] (1 protein) not a true family |
Protein automated matches [271639] (1 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271640] (1 PDB entry) |
Domain d2muia_: 2mui A: [271641] automated match to d2gzoa1 |
PDB Entry: 2mui (more details)
SCOPe Domain Sequences for d2muia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2muia_ d.310.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mkqssptylkhhfliamphmadpnfaqtvtylvehneqgamglvinrpsglnlaevleql kpdalpparcqhidiynggpvqtdrgfvlhpsglsyqstlelgelamstsqdvlfaiaag tgpekslislgyagweagqleaelsdnawltcpadpailfdlppeerlsaaaarlgvnls lltaqagha
Timeline for d2muia_: