Lineage for d2muia_ (2mui A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010604Fold d.310: VC0467-like [143455] (1 superfamily)
    complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel
  4. 3010605Superfamily d.310.1: VC0467-like [143456] (2 families) (S)
    automatically mapped to Pfam PF02622
  5. 3010624Family d.310.1.0: automated matches [271638] (1 protein)
    not a true family
  6. 3010625Protein automated matches [271639] (1 species)
    not a true protein
  7. 3010626Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271640] (1 PDB entry)
  8. 3010627Domain d2muia_: 2mui A: [271641]
    automated match to d2gzoa1

Details for d2muia_

PDB Entry: 2mui (more details)

PDB Description: solution structure of the algh protein from pseudomonas aeruginosa, pa0405, upf0301
PDB Compounds: (A:) UPF0301 protein AlgH

SCOPe Domain Sequences for d2muia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2muia_ d.310.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkqssptylkhhfliamphmadpnfaqtvtylvehneqgamglvinrpsglnlaevleql
kpdalpparcqhidiynggpvqtdrgfvlhpsglsyqstlelgelamstsqdvlfaiaag
tgpekslislgyagweagqleaelsdnawltcpadpailfdlppeerlsaaaarlgvnls
lltaqagha

SCOPe Domain Coordinates for d2muia_:

Click to download the PDB-style file with coordinates for d2muia_.
(The format of our PDB-style files is described here.)

Timeline for d2muia_: