PDB entry 2mui

View 2mui on RCSB PDB site
Description: Solution structure of the AlgH protein from Pseudomonas aeruginosa, PA0405, UPF0301
Class: unknown function
Keywords: AlgH, UNKNOWN FUNCTION
Deposited on 2014-09-10, released 2015-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0301 protein AlgH
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: algH, PA0405
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2muia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2muiA (A:)
    mkqssptylkhhfliamphmadpnfaqtvtylvehneqgamglvinrpsglnlaevleql
    kpdalpparcqhidiynggpvqtdrgfvlhpsglsyqstlelgelamstsqdvlfaiaag
    tgpekslislgyagweagqleaelsdnawltcpadpailfdlppeerlsaaaarlgvnls
    lltaqagha