Lineage for d1np1a_ (1np1 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169857Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 169858Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 169859Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
  6. 169941Protein Nitrophorin 1 [50841] (1 species)
  7. 169942Species Rhodnius prolixus [TaxId:13249] [50842] (4 PDB entries)
  8. 169943Domain d1np1a_: 1np1 A: [27155]

Details for d1np1a_

PDB Entry: 1np1 (more details), 2 Å

PDB Description: crystal structure of the complex of nitrophorin 1 from rhodnius prolixus with histamine

SCOP Domain Sequences for d1np1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np1a_ b.60.1.1 (A:) Nitrophorin 1 {Rhodnius prolixus}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

SCOP Domain Coordinates for d1np1a_:

Click to download the PDB-style file with coordinates for d1np1a_.
(The format of our PDB-style files is described here.)

Timeline for d1np1a_: