Lineage for d1qfva_ (1qfv A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 300928Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins)
    barrel, closed; n=8, S=12, meander
  6. 300983Protein Histamine binding protein [50839] (1 species)
  7. 300984Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [50840] (2 PDB entries)
  8. 300987Domain d1qfva_: 1qfv A: [27153]

Details for d1qfva_

PDB Entry: 1qfv (more details), 1.36 Å

PDB Description: histamine binding protein from female brown ear rhipicephalus appendiculatus

SCOP Domain Sequences for d1qfva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfva_ b.60.1.1 (A:) Histamine binding protein {Brown ear tick (Rhipicephalus appendiculatus)}
nqpdwadeaangahqdawkslkadvenvyymvkatykndpvwgndftcvgvmandvnede
ksiqaeflfmnnadtnmqfatekvtavkmygynrenafryetedgqvftdviaysddncd
viyvpgtdgneegyelwttdydnipanclnkfneyavgretrdvftsacleiaaa

SCOP Domain Coordinates for d1qfva_:

Click to download the PDB-style file with coordinates for d1qfva_.
(The format of our PDB-style files is described here.)

Timeline for d1qfva_: