SCOPe 2.04: Domain d1bbpc_: 1bbp C:

Lineage for d1bbpc_ (1bbp C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Bilin-binding protein [50837] (1 species)

7. Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)

8. Domain d1bbpc_: 1bbp C: [27149]
   complexed with blv

Details for d1bbpc_

PDB Entry: 1bbp, 2 Å

PDB Description: molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.

PDB Compounds: (C:) bilin binding protein

SCOPe Domain Sequences for d1bbpc_:

Sequence; same for both SEQRES and ATOM records:

>d1bbpc_ b.60.1.1 (C:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn

Timeline for d1bbpc_:

• d1bbpc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbpc_ appears in SCOPe 2.03
  
• d1bbpc_ appears in SCOPe 2.05
  
• d1bbpc_ appears in the current release, SCOPe 2.08