Lineage for d4q50f_ (4q50 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748003Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)
  8. 1748240Domain d4q50f_: 4q50 F: [271434]
    automated match to d3q95b_
    complexed with oht, so4; mutant

Details for d4q50f_

PDB Entry: 4q50 (more details), 3.07 Å

PDB Description: the estrogen receptor alpha ligand binding domain d538g mutant in complex with 4-hydroxytamoxifen
PDB Compounds: (F:) Estrogen receptor

SCOPe Domain Sequences for d4q50f_:

Sequence, based on SEQRES records: (download)

>d4q50f_ a.123.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplyglllemld

Sequence, based on observed residues (ATOM records): (download)

>d4q50f_ a.123.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseypfseasmmglltnladrelvhminwakrvpgfvdl
tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
tssrfrmmnlqgeefvclksiillnsgvtfsleekdhihrvldkitdtlihlmakagltl
qqqhqrlaqlllilshirhmsnkgmehlyslyglllemld

SCOPe Domain Coordinates for d4q50f_:

Click to download the PDB-style file with coordinates for d4q50f_.
(The format of our PDB-style files is described here.)

Timeline for d4q50f_: