Lineage for d4p3va_ (4p3v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715144Protein HU protein [47735] (5 species)
  7. 2715163Species Escherichia coli, beta-isoform [TaxId:562] [158508] (2 PDB entries)
    Uniprot P0ACF4 1-90
    HupB
  8. 2715164Domain d4p3va_: 4p3v A: [271406]
    automated match to d2o97b1
    complexed with li

Details for d4p3va_

PDB Entry: 4p3v (more details), 1.25 Å

PDB Description: crystal structure of the e. coli hu beta2 protein
PDB Compounds: (A:) DNA-binding protein HU-beta

SCOPe Domain Sequences for d4p3va_:

Sequence, based on SEQRES records: (download)

>d4p3va_ a.55.1.1 (A:) HU protein {Escherichia coli, beta-isoform [TaxId: 562]}
mnksqlidkiaagadiskaaagraldaiiasvteslkegddvalvgfgtfavkeraartg
rnpqtgkeitiaaakvpsfragkalkdavn

Sequence, based on observed residues (ATOM records): (download)

>d4p3va_ a.55.1.1 (A:) HU protein {Escherichia coli, beta-isoform [TaxId: 562]}
mnksqlidkiaagadiskaaagraldaiiasvteslkegddvalvgfgtfavkerakvps
fragkalkdavn

SCOPe Domain Coordinates for d4p3va_:

Click to download the PDB-style file with coordinates for d4p3va_.
(The format of our PDB-style files is described here.)

Timeline for d4p3va_: