SCOPe 2.06: Domain d4x1ba1: 4x1b A:3-333

Lineage for d4x1ba1 (4x1b A:3-333)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (31 PDB entries)

8. Domain d4x1ba1: 4x1b A:3-333 [271327]
   automated match to d4h0wa1
   complexed with fe, gol, mli

Details for d4x1ba1

PDB Entry: 4x1b, 2.45 Å

PDB Description: human serum transferrin with ferric ion bound at the c-lobe only

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d4x1ba1:

Sequence; same for both SEQRES and ATOM records:

>d4x1ba1 c.94.1.0 (A:3-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtcpe

Timeline for d4x1ba1:

• d4x1ba1 first appeared in SCOPe 2.05
  
• d4x1ba1 appears in SCOPe 2.07
  
• d4x1ba1 appears in the current release, SCOPe 2.08