Lineage for d4wuca1 (4wuc A:4-220)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580592Species Escherichia coli [TaxId:83333] [271298] (14 PDB entries)
  8. 2580604Domain d4wuca1: 4wuc A:4-220 [271306]
    Other proteins in same PDB: d4wuca2
    automated match to d4prxa1
    complexed with anp, cl, mg, na

Details for d4wuca1

PDB Entry: 4wuc (more details), 1.9 Å

PDB Description: n-terminal 43 kda fragment of the e. coli dna gyrase b subunit grown from 100 mm nacl condition
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4wuca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuca1 d.122.1.0 (A:4-220) automated matches {Escherichia coli [TaxId: 83333]}
sydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivti
hadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvv
nalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefe
yeilakrlrelsflnsgvsirlrdkrdgkedhfhyeg

SCOPe Domain Coordinates for d4wuca1:

Click to download the PDB-style file with coordinates for d4wuca1.
(The format of our PDB-style files is described here.)

Timeline for d4wuca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wuca2