Lineage for d4tw1n_ (4tw1 N:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628131Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2628132Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2628280Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 2628281Protein automated matches [227114] (6 species)
    not a true protein
  7. 2628305Species Staphylococcus aureus [TaxId:451516] [260976] (2 PDB entries)
  8. 2628320Domain d4tw1n_: 4tw1 N: [271250]
    automated match to d4tw1b_

Details for d4tw1n_

PDB Entry: 4tw1 (more details), 2.8 Å

PDB Description: crystal structure of the octameric pore complex of the staphylococcus aureus bi-component toxin lukgh
PDB Compounds: (N:) Possible leukocidin subunit

SCOPe Domain Sequences for d4tw1n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tw1n_ f.6.1.0 (N:) automated matches {Staphylococcus aureus [TaxId: 451516]}
apddigkngkitkrtetvydektnilqnlqfdfiddptydknvllvkkqgsihsnlkfes
hkeeknsnwlkypseyhvdfqvkrnrkteildqlpknkistakvdstfsyssggkfdstk
gigrtssnsysktisynqqnydtiasgknnnwhvhwsviandlkyggevknrndellfyr
ntriatvenpelsfaskyrypalvrsgfnpefltylsneksnektqfevtytrnqdilkn
rpgihyappileknkdgqrlivtyevdwknktvkvvdkysddnkpyke

SCOPe Domain Coordinates for d4tw1n_:

Click to download the PDB-style file with coordinates for d4tw1n_.
(The format of our PDB-style files is described here.)

Timeline for d4tw1n_: