Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries) |
Domain d4s1zd_: 4s1z D: [271236] automated match to d2murb_ complexed with zn |
PDB Entry: 4s1z (more details), 3.03 Å
SCOPe Domain Sequences for d4s1zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s1zd_ d.15.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrg
Timeline for d4s1zd_:
View in 3D Domains from other chains: (mouse over for more information) d4s1za_, d4s1zb_, d4s1zc_, d4s1ze_ |