Lineage for d1dv9a_ (1dv9 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 300928Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins)
    barrel, closed; n=8, S=12, meander
  6. 300947Protein beta-Lactoglobulin [50827] (2 species)
  7. 300948Species Cow (Bos taurus) [TaxId:9913] [50828] (15 PDB entries)
  8. 300966Domain d1dv9a_: 1dv9 A: [27123]

Details for d1dv9a_

PDB Entry: 1dv9 (more details)

PDB Description: structural changes accompanying ph-induced dissociation of the b- lactoglobulin dimer

SCOP Domain Sequences for d1dv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv9a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
ayvtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d1dv9a_:

Click to download the PDB-style file with coordinates for d1dv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1dv9a_: