SCOP 1.67: Domain d1b0o__: 1b0o -

Lineage for d1b0o__ (1b0o -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (15 PDB entries)

8. Domain d1b0o__: 1b0o - [27121]
   complexed with plm

Details for d1b0o__

PDB Entry: 1b0o, 2.5 Å

PDB Description: bovine beta-lactoglobulin complexed with palmitate, lattice z

SCOP Domain Sequences for d1b0o__:

Sequence; same for both SEQRES and ATOM records:

>d1b0o__ b.60.1.1 (-) beta-Lactoglobulin {Cow (Bos taurus)}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d1b0o__:

• d1b0o__ first appeared (with stable ids) in SCOP 1.55
  
• d1b0o__ appears in SCOP 1.65
  
• d1b0o__ appears in SCOP 1.69
  
• d1b0o__ appears in the current release, SCOPe 2.08, called d1b0oa_