Lineage for d1b0o__ (1b0o -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein beta-Lactoglobulin [50827] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50828] (9 PDB entries) 
Domain d1b0o__: 1b0o - [27121]
Details for d1b0o__
PDB Entry: 1b0o (more details), 2.5 Å
PDB Description: bovine beta-lactoglobulin complexed with palmitate, lattice z
SCOP Domain Sequences for d1b0o__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0o__ b.60.1.1 (-) beta-Lactoglobulin {Cow (Bos taurus)}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
SCOP Domain Coordinates for d1b0o__:
Click to download the PDB-style file with coordinates for d1b0o__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0o__:
- d1b0o__ appears in SCOP 1.57
- d1b0o__ appears in the current release, SCOPe 2.08, called d1b0oa_
View in 3D