Class b: All beta proteins [48724] (178 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [271156] (1 PDB entry) |
Domain d4ywnb_: 4ywn B: [271158] automated match to d4hx6e_ complexed with flc |
PDB Entry: 4ywn (more details), 1.8 Å
SCOPe Domain Sequences for d4ywnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ywnb_ b.45.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]} slreafghfpsgvvaiaaevngtleglaastfvpvsldpplvsfcvqntsttwpklkdrp mlgisvlgeehdeaartlaaktgdrfagletvsrptgavfikgtalwlesaveqlipagd htivvlrvnevtvdanvapiv
Timeline for d4ywnb_: