Lineage for d4ywnb_ (4ywn B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403929Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2403930Protein automated matches [190439] (22 species)
    not a true protein
  7. 2403969Species Mycobacterium avium [TaxId:243243] [271156] (1 PDB entry)
  8. 2403971Domain d4ywnb_: 4ywn B: [271158]
    automated match to d4hx6e_
    complexed with flc

Details for d4ywnb_

PDB Entry: 4ywn (more details), 1.8 Å

PDB Description: crystal structure of nadh-fmn oxidoreductase from mycobacterium avium
PDB Compounds: (B:) NADH-fmn oxidoreductase

SCOPe Domain Sequences for d4ywnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ywnb_ b.45.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
slreafghfpsgvvaiaaevngtleglaastfvpvsldpplvsfcvqntsttwpklkdrp
mlgisvlgeehdeaartlaaktgdrfagletvsrptgavfikgtalwlesaveqlipagd
htivvlrvnevtvdanvapiv

SCOPe Domain Coordinates for d4ywnb_:

Click to download the PDB-style file with coordinates for d4ywnb_.
(The format of our PDB-style files is described here.)

Timeline for d4ywnb_: