Lineage for d4yhra2 (4yhr A:127-256)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215978Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2216000Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2216029Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (2 PDB entries)
  8. 2216035Domain d4yhra2: 4yhr A:127-256 [270907]
    automated match to d1plqa2

Details for d4yhra2

PDB Entry: 4yhr (more details), 2.95 Å

PDB Description: crystal structure of yeast proliferating cell nuclear antigen
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4yhra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yhra2 d.131.1.2 (A:127-256) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfnd

SCOPe Domain Coordinates for d4yhra2:

Click to download the PDB-style file with coordinates for d4yhra2.
(The format of our PDB-style files is described here.)

Timeline for d4yhra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yhra1