SCOP 1.61: Domain d1qabe_: 1qab E:

Lineage for d1qabe_ (1qab E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)

4. Superfamily b.60.1: Lipocalins [50814] (3 families)

5. Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)

6. Protein Retinol binding protein [50816] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50819] (4 PDB entries)

8. Domain d1qabe_: 1qab E: [27088]
   Other proteins in same PDB: d1qaba_, d1qabb_, d1qabc_, d1qabd_

Details for d1qabe_

PDB Entry: 1qab, 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP

SCOP Domain Sequences for d1qabe_:

Sequence; same for both SEQRES and ATOM records:

>d1qabe_ b.60.1.1 (E:) Retinol binding protein {Human (Homo sapiens)}
cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngycdgrsernll

Timeline for d1qabe_:

• d1qabe_ first appeared (with stable ids) in SCOP 1.55
  
• d1qabe_ appears in SCOP 1.59
  
• d1qabe_ appears in SCOP 1.63
  
• d1qabe_ appears in the current release, SCOPe 2.08