Lineage for d1fu1a1 (1fu1 A:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413741Fold b.59: XRCC4, N-terminal domain [50808] (1 superfamily)
    barrel, closed; n=7, S=10; order: 1234765; strands 1 and 5 are parallel to each other
  4. 2413742Superfamily b.59.1: XRCC4, N-terminal domain [50809] (1 family) (S)
    an HTH motif connects strands 4 and 5
  5. 2413743Family b.59.1.1: XRCC4, N-terminal domain [50810] (2 proteins)
  6. 2413744Protein XRCC4, N-terminal domain [50811] (1 species)
  7. 2413745Species Human (Homo sapiens) [TaxId:9606] [50812] (4 PDB entries)
  8. 2413748Domain d1fu1a1: 1fu1 A:1-117 [27076]
    Other proteins in same PDB: d1fu1a2, d1fu1b2
    CASP4
    complexed with acy

Details for d1fu1a1

PDB Entry: 1fu1 (more details), 2.7 Å

PDB Description: crystal structure of human xrcc4
PDB Compounds: (A:) DNA repair protein xrcc4

SCOPe Domain Sequences for d1fu1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fu1a1 b.59.1.1 (A:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma
mekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekve

SCOPe Domain Coordinates for d1fu1a1:

Click to download the PDB-style file with coordinates for d1fu1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fu1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fu1a2