Class b: All beta proteins [48724] (178 folds) |
Fold b.59: XRCC4, N-terminal domain [50808] (1 superfamily) barrel, closed; n=7, S=10; order: 1234765; strands 1 and 5 are parallel to each other |
Superfamily b.59.1: XRCC4, N-terminal domain [50809] (1 family) an HTH motif connects strands 4 and 5 |
Family b.59.1.1: XRCC4, N-terminal domain [50810] (2 proteins) |
Protein XRCC4, N-terminal domain [50811] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50812] (4 PDB entries) |
Domain d1fu1a1: 1fu1 A:1-117 [27076] Other proteins in same PDB: d1fu1a2, d1fu1b2 CASP4 complexed with acy |
PDB Entry: 1fu1 (more details), 2.7 Å
SCOPe Domain Sequences for d1fu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fu1a1 b.59.1.1 (A:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma mekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekve
Timeline for d1fu1a1: