SCOPe 2.06: Domain d4v0wa1: 4v0w A:7-300

Lineage for d4v0wa1 (4v0w A:7-300)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (5 PDB entries)

8. Domain d4v0wa1: 4v0w A:7-300 [270710]
   Other proteins in same PDB: d4v0wa2, d4v0wc2
   automated match to d2o8ga_
   complexed with mn

Details for d4v0wa1

PDB Entry: 4v0w, 1.55 Å

PDB Description: the crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-669)

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d4v0wa1:

Sequence; same for both SEQRES and ATOM records:

>d4v0wa1 d.159.1.3 (A:7-300) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpae

Timeline for d4v0wa1:

• d4v0wa1 first appeared in SCOPe 2.05, called d4v0wa_
  
• d4v0wa1 appears in SCOPe 2.07
  
• d4v0wa1 appears in the current release, SCOPe 2.08