| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
| Protein Protein phosphatase-1 (PP-1) [56311] (5 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (5 PDB entries) |
| Domain d4v0wa1: 4v0w A:7-300 [270710] Other proteins in same PDB: d4v0wa2, d4v0wc2 automated match to d2o8ga_ complexed with mn |
PDB Entry: 4v0w (more details), 1.55 Å
SCOPe Domain Sequences for d4v0wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v0wa1 d.159.1.3 (A:7-300) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpae
Timeline for d4v0wa1: