Lineage for d1e0tc1 (1e0t C:70-167)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551526Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1551527Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1551528Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1551529Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1551537Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 1551540Domain d1e0tc1: 1e0t C:70-167 [27066]
    Other proteins in same PDB: d1e0ta2, d1e0ta3, d1e0tb2, d1e0tb3, d1e0tc2, d1e0tc3, d1e0td2, d1e0td3
    complexed with so4; mutant

Details for d1e0tc1

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase
PDB Compounds: (C:) pyruvate kinase

SCOPe Domain Sequences for d1e0tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0tc1 b.58.1.1 (C:70-167) Pyruvate kinase (PK) {Escherichia coli [TaxId: 562]}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOPe Domain Coordinates for d1e0tc1:

Click to download the PDB-style file with coordinates for d1e0tc1.
(The format of our PDB-style files is described here.)

Timeline for d1e0tc1: