Lineage for d1e0ta1 (1e0t A:70-167)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413578Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2413579Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2413580Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2413581Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2413589Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 2413590Domain d1e0ta1: 1e0t A:70-167 [27064]
    Other proteins in same PDB: d1e0ta2, d1e0ta3, d1e0tb2, d1e0tb3, d1e0tc2, d1e0tc3, d1e0td2, d1e0td3
    complexed with so4; mutant

Details for d1e0ta1

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d1e0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ta1 b.58.1.1 (A:70-167) Pyruvate kinase (PK) {Escherichia coli [TaxId: 562]}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOPe Domain Coordinates for d1e0ta1:

Click to download the PDB-style file with coordinates for d1e0ta1.
(The format of our PDB-style files is described here.)

Timeline for d1e0ta1: