Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (32 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [188612] (12 PDB entries) |
Domain d4r87c_: 4r87 C: [270399] automated match to d3eg7b_ complexed with coa, peg, spm |
PDB Entry: 4r87 (more details), 2.61 Å
SCOPe Domain Sequences for d4r87c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r87c_ d.108.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
Timeline for d4r87c_: