| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (32 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [188612] (12 PDB entries) |
| Domain d3eg7b_: 3eg7 B: [174921] automated match to d1nsla_ complexed with ipa, mg |
PDB Entry: 3eg7 (more details), 2.38 Å
SCOPe Domain Sequences for d3eg7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eg7b_ d.108.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
namnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrf
vvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhk
iylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
Timeline for d3eg7b_: