SCOPe 2.06: Domain d4mpva_: 4mpv A:

Lineage for d4mpva_ (4mpv A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (20 PDB entries)

8. Domain d4mpva_: 4mpv A: [270296]
   automated match to d1a0la_
   complexed with 2a4, cl, mes, so4

Details for d4mpva_

PDB Entry: 4mpv, 2.31 Å

PDB Description: human beta-tryptase co-crystal structure with (2r,4s)-n,n'-bis[3-({4- [3-(aminomethyl)phenyl]piperidin-1-yl}carbonyl)phenyl]-4-hydroxy-2- (2-hydroxypropan-2-yl)-5,5-dimethyl-1,3-dioxolane-2,4-dicarboxamide

PDB Compounds: (A:) tryptase alpha/beta-1

SCOPe Domain Sequences for d4mpva_:

Sequence; same for both SEQRES and ATOM records:

>d4mpva_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d4mpva_:

• d4mpva_ first appeared in SCOPe 2.05
  
• d4mpva_ appears in SCOPe 2.07
  
• d4mpva_ appears in the current release, SCOPe 2.08