SCOPe 2.07: Domain d4m0ua2: 4m0u A:161-312

Lineage for d4m0ua2 (4m0u A:161-312)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)

8. Domain d4m0ua2: 4m0u A:161-312 [270264]
   automated match to d4f8ea2
   complexed with so4; mutant

Details for d4m0ua2

PDB Entry: 4m0u, 2.74 Å

PDB Description: crystal structure of human prs1 q133p mutant

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase 1

SCOPe Domain Sequences for d4m0ua2:

Sequence, based on SEQRES records:

>d4m0ua2 c.61.1.0 (A:161-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd
dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk
mkhcskiqvidismilaeairrthngesvsyl

Sequence, based on observed residues (ATOM records):

>d4m0ua2 c.61.1.0 (A:161-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkedrmvlvgdvkdrvailvddmadtcg
tichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcski
qvidismilaeairrthngesvsyl

Timeline for d4m0ua2:

• d4m0ua2 first appeared in SCOPe 2.05
  
• d4m0ua2 appears in SCOPe 2.06
  
• d4m0ua2 appears in the current release, SCOPe 2.08