SCOPe 2.07: Domain d4s1ja_: 4s1j A:

Lineage for d4s1ja_ (4s1j A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (21 species)
   not a true protein

7. Species Leishmania donovani [TaxId:981087] [269890] (1 PDB entry)

8. Domain d4s1ja_: 4s1j A: [269891]
   automated match to d2haqa_
   mutant

Details for d4s1ja_

PDB Entry: 4s1j, 2.3 Å

PDB Description: crystal structure of cyclophilin mutant v33a from leishmania donovani at 2.3 angstrom.

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4s1ja_:

Sequence; same for both SEQRES and ATOM records:

>d4s1ja_ b.62.1.1 (A:) automated matches {Leishmania donovani [TaxId: 981087]}
epevtakvyfdamidseplgritiglfgkdaplttenfrqlctgehgfgykdsifhrvip
nfmiqggdftnfdgtggksiygekfadenlkvkhfvgalsmanagpntngsqffittapt
pwldgrhvvfgkvldgmdvvlriektktnshdrpvkpvkivasgel

Timeline for d4s1ja_:

• d4s1ja_ first appeared in SCOPe 2.05
  
• d4s1ja_ appears in SCOPe 2.06
  
• d4s1ja_ appears in the current release, SCOPe 2.08