SCOPe 2.08: Domain d4rd9a_: 4rd9 A:

Lineage for d4rd9a_ (4rd9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families)
   the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)

5. Family a.47.4.0: automated matches [191661] (1 protein)
   not a true family

6. Protein automated matches [191241] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189704] (7 PDB entries)

8. Domain d4rd9a_: 4rd9 A: [269846]
   automated match to d3q7ga_

Details for d4rd9a_

PDB Entry: 4rd9, 2.6 Å

PDB Description: x-ray structure of the apo form of the amyloid precursor protein-like protein 1 (aplp1) e2 domain

PDB Compounds: (A:) Amyloid-like protein 1

SCOPe Domain Sequences for d4rd9a_:

Sequence; same for both SEQRES and ATOM records:

>d4rd9a_ a.47.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geisehegflrakmdleerrmrqinevmrewamadnqsknlpkadrqalnehfqsilqtl
eeqvsgerqrlvethatrvialindqrraalegflaalqadppqaervllalrrylraeq
keqrhtlrhyqhvaavdpekaqqmrfqvhthlqvieervnqslglldqnphlaqelrpqi
qellhseh

Timeline for d4rd9a_:

• d4rd9a_ first appeared in SCOPe 2.05
  
• d4rd9a_ appears in SCOPe 2.07