Lineage for d1aqcb_ (1aqc B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071257Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2071320Protein X11 [50756] (1 species)
  7. 2071321Species Human (Homo sapiens) [TaxId:9606] [50757] (2 PDB entries)
  8. 2071323Domain d1aqcb_: 1aqc B: [26984]

Details for d1aqcb_

PDB Entry: 1aqc (more details), 2.3 Å

PDB Description: x11 ptb domain-10mer peptide complex
PDB Compounds: (B:) x11

SCOPe Domain Sequences for d1aqcb_:

Sequence, based on SEQRES records: (download)

>d1aqcb_ b.55.1.2 (B:) X11 {Human (Homo sapiens) [TaxId: 9606]}
iifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevd
lfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqenveashps
qdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp

Sequence, based on observed residues (ATOM records): (download)

>d1aqcb_ b.55.1.2 (B:) X11 {Human (Homo sapiens) [TaxId: 9606]}
iifaanylgstqllnvrmmqaqeavsrikmaqklatevdlfiltqrikvlnadtqetmmd
hplrtisyiadignivvlmarrrykmichvfesedaqliaqsigqafsvayqeflrangi
np

SCOPe Domain Coordinates for d1aqcb_:

Click to download the PDB-style file with coordinates for d1aqcb_.
(The format of our PDB-style files is described here.)

Timeline for d1aqcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aqca_