Lineage for d1fhxb_ (1fhx B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1550802Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1550905Protein Grp1 [50751] (1 species)
    ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog
  7. 1550906Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries)
  8. 1550916Domain d1fhxb_: 1fhx B: [26981]
    complexed with 4ip, so4

Details for d1fhxb_

PDB Entry: 1fhx (more details), 2.5 Å

PDB Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (B:) guanine nucleotide exchange factor and integrin binding protein homolog grp1

SCOPe Domain Sequences for d1fhxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhxb_ b.55.1.1 (B:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
npdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprk
pncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdp
fydmla

SCOPe Domain Coordinates for d1fhxb_:

Click to download the PDB-style file with coordinates for d1fhxb_.
(The format of our PDB-style files is described here.)

Timeline for d1fhxb_: