Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Grp1 [50751] (1 species) ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog |
Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries) |
Domain d1fhxa_: 1fhx A: [26980] complexed with 4ip, so4 |
PDB Entry: 1fhx (more details), 2.5 Å
SCOPe Domain Sequences for d1fhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhxa_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} npdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprk pncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdp fyd
Timeline for d1fhxa_: