SCOPe 2.08: Domain d1fhxa_: 1fhx A:

Lineage for d1fhxa_ (1fhx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Grp1 [50751] (1 species)
   ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog

7. Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries)

8. Domain d1fhxa_: 1fhx A: [26980]
   complexed with 4ip, so4

Details for d1fhxa_

PDB Entry: 1fhx, 2.5 Å

PDB Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol 1,3,4,5-tetrakisphosphate

PDB Compounds: (A:) guanine nucleotide exchange factor and integrin binding protein homolog grp1

SCOPe Domain Sequences for d1fhxa_:

Sequence; same for both SEQRES and ATOM records:

>d1fhxa_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
npdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprk
pncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdp
fyd

Timeline for d1fhxa_:

• d1fhxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fhxa_ appears in SCOPe 2.07