Lineage for d1fhxa_ (1fhx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803190Protein Grp1 [50751] (1 species)
    ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog
  7. 2803191Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries)
  8. 2803200Domain d1fhxa_: 1fhx A: [26980]
    complexed with 4ip, so4

Details for d1fhxa_

PDB Entry: 1fhx (more details), 2.5 Å

PDB Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (A:) guanine nucleotide exchange factor and integrin binding protein homolog grp1

SCOPe Domain Sequences for d1fhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhxa_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
npdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprk
pncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdp
fyd

SCOPe Domain Coordinates for d1fhxa_:

Click to download the PDB-style file with coordinates for d1fhxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fhxa_: