SCOPe 2.05: Domain d4qbvb_: 4qbv B:

Lineage for d4qbvb_ (4qbv B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d4qbvb_: 4qbv B: [269796]
   automated match to d3ojma_
   complexed with flc; mutant

Details for d4qbvb_

PDB Entry: 4qbv, 1.5 Å

PDB Description: crystal structure of c117t mutant of human acidic fibroblast growth factor in sodium citrate buffer

PDB Compounds: (B:) fibroblast growth factor 1

SCOPe Domain Sequences for d4qbvb_:

Sequence; same for both SEQRES and ATOM records:

>d4qbvb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
tkrgprthygqkailflplpv

Timeline for d4qbvb_:

• d4qbvb_ is new in SCOPe 2.05-stable
  
• d4qbvb_ is called d4qbvb1 in SCOPe 2.06
  
• d4qbvb_ appears in the current release, SCOPe 2.08, called d4qbvb1