Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4ptta1: 4ptt A:1-107 [269786] Other proteins in same PDB: d4ptta2, d4pttb_ automated match to d1um5l1 complexed with act, gol |
PDB Entry: 4ptt (more details), 1.8 Å
SCOPe Domain Sequences for d4ptta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ptta1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgergtlscrasqsvgtylawyqhkpgqaprpliydasrratgipa rfsgsgsgtdftltisglepedvavyycqhrdswppgatfgggtkveik
Timeline for d4ptta1: