SCOPe 2.05: Domain d4ptta1: 4ptt A:1-107

Lineage for d4ptta1 (4ptt A:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4ptta1: 4ptt A:1-107 [269786]
   Other proteins in same PDB: d4ptta2
   automated match to d1um5l1
   complexed with act, gol

Details for d4ptta1

PDB Entry: 4ptt, 1.8 Å

PDB Description: crystal structure of anti-23f strep fab c05

PDB Compounds: (A:) Antibody pn132p2C05, light chain

SCOPe Domain Sequences for d4ptta1:

Sequence; same for both SEQRES and ATOM records:

>d4ptta1 b.1.1.0 (A:1-107) automated matches {Homo sapiens [TaxId: 9606]}
eivltqspatlslspgergtlscrasqsvgtylawyqhkpgqaprpliydasrratgipa
rfsgsgsgtdftltisglepedvavyycqhrdswppgatfgggtkveik

Timeline for d4ptta1:

• d4ptta1 is new in SCOPe 2.05-stable
  
• d4ptta1 appears in SCOPe 2.06
  
• d4ptta1 appears in the current release, SCOPe 2.08