| Class b: All beta proteins [48724] (178 folds) |
| Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
| Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
| Protein automated matches [254706] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
| Domain d5aena1: 5aen A:3-208 [269604] Other proteins in same PDB: d5aena2, d5aena3 automated match to d3b7sa2 complexed with dp8, imd, yb, zn |
PDB Entry: 5aen (more details), 1.86 Å
SCOPe Domain Sequences for d5aena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aena1 b.98.1.0 (A:3-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga
Timeline for d5aena1: