| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
| Protein automated matches [190417] (37 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [194605] (31 PDB entries) |
| Domain d4xi2a2: 4xi2 A:384-657 [269603] Other proteins in same PDB: d4xi2a1 automated match to d2ptka3 complexed with au |
PDB Entry: 4xi2 (more details), 2.6 Å
SCOPe Domain Sequences for d4xi2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xi2a2 d.144.1.0 (A:384-657) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmiregsmsedefi
eeakvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemck
dvceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrw
sppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlas
ervytimyscwhekaderpsfkillsnildvmde
Timeline for d4xi2a2: