SCOPe 2.07: Domain d4xi2a2: 4xi2 A:384-657

Lineage for d4xi2a2 (4xi2 A:384-657)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [194605] (30 PDB entries)

8. Domain d4xi2a2: 4xi2 A:384-657 [269603]
   Other proteins in same PDB: d4xi2a1
   automated match to d2ptka3
   complexed with au

Details for d4xi2a2

PDB Entry: 4xi2, 2.6 Å

PDB Description: crystal structure of an auto-inhibited form of bruton's tryrosine kinase

PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d4xi2a2:

Sequence; same for both SEQRES and ATOM records:

>d4xi2a2 d.144.1.0 (A:384-657) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmiregsmsedefi
eeakvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemck
dvceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrw
sppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlas
ervytimyscwhekaderpsfkillsnildvmde

Timeline for d4xi2a2:

• d4xi2a2 first appeared in SCOPe 2.05
  
• d4xi2a2 appears in SCOPe 2.06
  
• d4xi2a2 appears in the current release, SCOPe 2.08