SCOPe 2.03: Domain d1cl3a_: 1cl3 A:

Lineage for d1cl3a_ (1cl3 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
   barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices

4. Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family)
   automatically mapped to Pfam PF02312

5. Family b.54.1.1: Core binding factor beta, CBF [50724] (1 protein)

6. Protein Core binding factor beta, CBF [50725] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50726] (3 PDB entries)

8. Domain d1cl3a_: 1cl3 A: [26949]

Details for d1cl3a_

PDB Entry: 1cl3

PDB Description: molecular insights into pebp2/cbf-smmhc associated acute leukemia revealed from the three-dimensional structure of pebp2/cbf beta

PDB Compounds: (A:) polyomavirus enhancer binding protein 2

SCOPe Domain Sequences for d1cl3a_:

Sequence; same for both SEQRES and ATOM records:

>d1cl3a_ b.54.1.1 (A:) Core binding factor beta, CBF {Human (Homo sapiens) [TaxId: 9606]}
vvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatgtn
lslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmg
clefdeeraqqedalaqq

Timeline for d1cl3a_:

• d1cl3a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cl3a_ appears in SCOPe 2.02
  
• d1cl3a_ appears in SCOPe 2.04
  
• d1cl3a_ appears in the current release, SCOPe 2.08