PDB entry 1cl3

View 1cl3 on RCSB PDB site
Description: molecular insights into pebp2/cbf-smmhc associated acute leukemia revealed from the three-dimensional structure of pebp2/cbf beta
Class: gene regulation
Keywords: structure from molmol, core-binding factor, gene regulation
Deposited on 1999-05-04, released 2000-01-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyomavirus enhancer binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13951 (0-137)
      • conflict (38)
      • conflict (113)
    Domains in SCOPe 2.03: d1cl3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cl3A (A:)
    vvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatgtn
    lslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmg
    clefdeeraqqedalaqq